bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0209_orf2 Length=116 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_3330 136 2e-31 > 5807.cgd5_3330 Length=210 Score = 136 bits (342), Expect = 2e-31, Method: Compositional matrix adjust. Identities = 62/106 (58%), Positives = 85/106 (80%), Gaps = 1/106 (0%) Query 11 SYIFGVSSYFFSGSMINVMTYIWGRRNPNTRLSIFFMPVQAPYLPFLLALLSLLVGWNMA 70 SY FG + Y FSG++INVMTYIWGRRNP+ R+S+F V+APYLP++L + L++GW Sbjct 106 SYFFG-AGYLFSGAVINVMTYIWGRRNPSARMSVFIFTVRAPYLPWVLMGMGLVIGWRPW 164 Query 71 DHLVGIAVGHFYYFFEDVYPLLPTSKGFRIFRTPRILMWLLKQPED 116 D+L+GI VGH YYFFED+YPL+P S GFR+F+TP+I+ L+KQ ++ Sbjct 165 DNLMGIIVGHTYYFFEDIYPLMPISNGFRLFKTPKIITKLMKQEQN 210 Lambda K H 0.334 0.147 0.494 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40