bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0229_orf1 Length=266 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI0740c 288 1e-76 > 5833.PFI0740c Length=159 Score = 288 bits (738), Expect = 1e-76, Method: Compositional matrix adjust. Identities = 130/159 (81%), Positives = 145/159 (91%), Gaps = 1/159 (0%) Query 108 SIARKRLAQERAAWRRDHPAGFSAKYAPMADGSVGQDIMKWICKVPGKKGSIWEGGEYCL 167 SIA+KRLAQERA WR+DHPAGFSAKY+PM+DG G DIMKWICK+PGKKG +WEGGEY L Sbjct 2 SIAKKRLAQERAEWRKDHPAGFSAKYSPMSDGK-GLDIMKWICKIPGKKGGLWEGGEYPL 60 Query 168 TMEFSEEYPSKPPKCKFAPVLFHPNVYPSGTVCLSILNEDEDWKPSITIKQILLGIQDLL 227 TMEF+E+YPSKPPKCKF VLFHPN+YPSGTVCLSILNEDEDWKPSITIKQILLGIQDLL Sbjct 61 TMEFTEDYPSKPPKCKFTTVLFHPNIYPSGTVCLSILNEDEDWKPSITIKQILLGIQDLL 120 Query 228 DNPNPQSPAQAEPYMLYCQNRDEYNRRVKNQAIQMRPKD 266 DNPNP SPAQAEP++LY Q+RD Y ++VK QAI+ RPKD Sbjct 121 DNPNPNSPAQAEPFLLYQQDRDSYEKKVKKQAIEFRPKD 159 Lambda K H 0.314 0.128 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 84358518300 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40