bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0252_orf2 Length=215 Score E Sequences producing significant alignments: (Bits) Value 4952.YALI0E15466g 72.0 1e-11 > 4952.YALI0E15466g Length=192 Score = 72.0 bits (175), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 40/110 (36%), Positives = 58/110 (52%), Gaps = 3/110 (2%) Query 22 FREAVSAVLAQWTLLNLAVEQGWGGRDSHRKRQKLYEDLIAEFRENKNVDVEDLACTLSE 81 F V L WT L AV+ WGG DS KR+ L +++ F E+ +D D+ LS+ Sbjct 24 FELGVCMALYNWTDLTTAVDNSWGGSDSEEKREWLVGNIVELFEESTVLDALDIQTRLSQ 83 Query 82 RLASDFSVSVEDDSDLEVAQLLVDLHEQISRGCFDLASVVKQQQNQRATS 131 + +F V+DDSD AQLL+ + + S+G F S V+ Q N+ S Sbjct 84 VMEDEFDTVVDDDSDFTTAQLLIQIWMECSQGIF---STVENQYNKYEKS 130 Lambda K H 0.310 0.124 0.345 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 56120981916 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40