bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0365_orf1 Length=163 Score E Sequences producing significant alignments: (Bits) Value 4896.SPBC9B6.02 70.1 2e-11 > 4896.SPBC9B6.02 Length=1108 Score = 70.1 bits (170), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 38/111 (34%), Positives = 62/111 (55%), Gaps = 10/111 (9%) Query 2 ITYLGYIISAAGIKPAKDKIAAIQHWPEVLENETQVRQFLGTINYCRMFMGPDYADVARP 61 + ++GY IS G P ++ I + W + +N ++RQFLG++NY R F+ P + + P Sbjct 608 VKFIGYHISEKGFTPCQENIDKVLQWKQP-KNRKELRQFLGSVNYLRKFI-PKTSQLTHP 665 Query 62 LVHLTRKDVSFEWTELHTQAVRQLKQRLI--------DFTYKSLTSRNPSS 104 L +L +KDV ++WT TQA+ +KQ L+ DF+ K L + S Sbjct 666 LNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASD 716 Lambda K H 0.321 0.131 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28009217385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40