bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0371_orf2 Length=122 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL1P1.24 191 4e-48 > 5833.MAL1P1.24 Length=380 Score = 191 bits (486), Expect = 4e-48, Method: Composition-based stats. Identities = 85/120 (70%), Positives = 107/120 (89%), Gaps = 0/120 (0%) Query 3 RAPEILFHPSLVGLEYPGVHELVVNSISRADLDLRRTLFSQIVLAGGSTYFHGFGDRLLN 62 RAPE+LF+PS++GLEY G+ EL+V SI+RAD+DLR+TL+S IVL+GG+T F GFGDRLLN Sbjct 261 RAPEVLFNPSILGLEYLGLSELIVTSITRADMDLRKTLYSHIVLSGGTTLFQGFGDRLLN 320 Query 63 EIRKAAPKDIKIRISAPPERKFSTWIGGSILASLSSFKKMWVPRQEYEECGPSILHRKTL 122 EIRK APKDI IRISAPPERKFST+IGGSILASL++FKK+W+ +QE++E G ILH+K+ Sbjct 321 EIRKFAPKDITIRISAPPERKFSTFIGGSILASLATFKKIWISKQEFDEYGSVILHKKSF 380 Lambda K H 0.321 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40