bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0376_orf2 Length=185 Score E Sequences producing significant alignments: (Bits) Value 5207.CNC06560 60.5 3e-08 > 5207.CNC06560 Length=675 Score = 60.5 bits (145), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 28/70 (40%), Positives = 40/70 (57%), Gaps = 2/70 (2%) Query 94 VLCRYFQSGYCPAGESCTFIHSSEDSITPATQQCKNFLMGSCKNGINCPFAHSTPHSSSS 153 V CR+F++G C AGESC F H++ DS + C+ FL G+CK G C AH P S Sbjct 149 VPCRFFKAGACTAGESCPFSHAAPDSAK--REVCQWFLKGNCKFGHKCALAHVRPGEPMS 206 Query 154 QRQQQQRQQQ 163 ++ ++ Q Sbjct 207 MDRKNKKAAQ 216 Lambda K H 0.310 0.118 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40134932565 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40