bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0384_orf9 Length=539 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_4060 71.6 6e-11 > 5807.cgd7_4060 Length=680 Score = 71.6 bits (174), Expect = 6e-11, Method: Compositional matrix adjust. Identities = 51/150 (34%), Positives = 80/150 (53%), Gaps = 10/150 (6%) Query 392 QVYVHRLMRWLPMSLDLFDSEDVEKQLLPP--SSRRAPAAAAAAAAAGKPAADKKKKRKK 449 +VY+ +L + LP S+ D+E +EK P S + + + + + A K K++K Sbjct 533 KVYLRQLDKKLPSSVFSIDAEVLEKMEAPTRASEKDSHDSKSMSHANLTIKTKSKHKKRK 592 Query 450 IKYPKGWDPSKPQMPPDPERWKPKHERSGYKKMLRKRK----ECLRGGAQGAVAPGIAEA 505 +YPKG+DP P PDPERW PK +RS +KK+ + R + +GG QGA+ EA Sbjct 593 PRYPKGFDPLNPGQEPDPERWLPKEQRSSFKKLNKNRSSKKGQIGKGGHQGAIPTSNIEA 652 Query 506 VTGFRDSGPTTAKTKAATDEGTMRAITRKK 535 + + P+TAK A + +R +KK Sbjct 653 ----KPTVPSTAKQAALSSSSGIRRSHKKK 678 Lambda K H 0.314 0.125 0.338 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 237582232678 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40