bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0436_orf2 Length=178 Score E Sequences producing significant alignments: (Bits) Value 243233.MCA2793 230 2e-59 > 243233.MCA2793 Length=334 Score = 230 bits (586), Expect = 2e-59, Method: Compositional matrix adjust. Identities = 110/178 (61%), Positives = 140/178 (78%), Gaps = 1/178 (0%) Query 1 CKQPFNLARAGADMVCPSEMMDGRVTAIREALDMEGCVDTSVLSYACKYASSLYGPFRDA 60 KQ + A AGAD+V PS+MMDGR+ AIR+AL+ EG V+T +L+Y+ KYASS YGPFRDA Sbjct 157 VKQALSHAAAGADVVAPSDMMDGRIGAIRQALEAEGFVNTRILAYSAKYASSFYGPFRDA 216 Query 61 VGSPLK-GTGDKKTYQMDISNALEAEREAELDVQEGADMLMVKPGSSYLDVLRRVRQKTN 119 VGS G G+K +YQMD +N EA RE ELD+QEGADM+MVKPG YLD++RRV+ + Sbjct 217 VGSAANLGGGNKYSYQMDPANGDEALREVELDLQEGADMVMVKPGMPYLDIVRRVKDRFG 276 Query 120 VPLAVYQVSGEYAMIKAAAEKGWINEKAVVLETLKGFRRAGADAIATYYAKDFAKWME 177 VP YQVSGEY+M+KAAA+ GW++E+AVVLE+L F+RAGAD I TY+AKD A W++ Sbjct 277 VPTYAYQVSGEYSMLKAAAQNGWLDERAVVLESLLAFKRAGADGILTYFAKDVATWLK 334 Lambda K H 0.317 0.131 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35812709058 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40