bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0437_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value 393595.ABO_0649 121 1e-26 > 393595.ABO_0649 Length=195 Score = 121 bits (303), Expect = 1e-26, Method: Compositional matrix adjust. Identities = 58/115 (50%), Positives = 81/115 (70%), Gaps = 3/115 (2%) Query 30 FSLPPLPYKPDALEPYISAKTIEHHYGKHHKAYVDNLNALVKDSNNPIHQKLETIIKNEK 89 F LPPLP++ +ALEP+ISA+T+E+H+GKHH AYV LN +V ++N + LE IIK+ + Sbjct 3 FELPPLPFEKNALEPHISAETLEYHHGKHHNAYVTKLNDMVAGTDNE-GKSLEEIIKSAE 61 Query 90 GNIYNQAAQVWNHTFYFNCLGPPSEETAAPLGPTLKRLERDFGSLENFKNEFKKK 144 G ++NQAAQVWNHTFY+N L P AP G +++ FGS + FK++F K Sbjct 62 GGLFNQAAQVWNHTFYWNSLSPNG--GGAPSGDLGAAIDKAFGSFDEFKDQFNAK 114 Lambda K H 0.317 0.132 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40