bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0520_orf3 Length=361 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.182 160 5e-38 > 5833.MAL13P1.182 Length=282 Score = 160 bits (406), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 70/213 (32%), Positives = 129/213 (60%), Gaps = 0/213 (0%) Query 60 DWMRNLGEVELFEVDLQHLVLNYLTINGLAEAAEEFVKEARIEPQMPLHCIDCRAKIREA 119 +W++ ++ E D+ +++NY ++ + + A+EF KE+ ++P MP++ + R I+ Sbjct 18 NWLKEFENTKINENDINEVLMNYFCVHRMYDVAKEFQKESNVKPDMPINTVKIRYLIQNE 77 Query 120 ILSGRTDEAIRQIGFIDPNLLSADAEVTFLLHKQQLLKLIETGELGDAIDFAQRHLAPCV 179 I++ + +EAI I +D +L ++ F L KQQLLKLI + +AI ++Q+ LA V Sbjct 78 IMNNKIEEAIEHINNLDKGILKKHKDLVFFLKKQQLLKLILNNNINEAIIYSQQELASYV 137 Query 180 KECPHLLPHLEEAMALLAFSDLSCPEAQRLIGGMEQREETARRIDEAILDLYRIEQESAL 239 KE P L+ +++ M L+A+ D + EA+ LI +E+++ T +RID+ IL+ Y ++ ES L Sbjct 138 KEKPSLINEIDDVMMLMAYQDFNNEEAKNLIQKIEKKKNTLKRIDDIILNYYNVDSESTL 197 Query 240 ELLAKNILFSQGCLQNAQRSLCPVILDVRRGTL 272 E + KN+ F+Q L + P I +++ G + Sbjct 198 EYMVKNVFFTQNVLSSKYPCSVPKIKNLKSGYI 230 Lambda K H 0.319 0.136 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 138065755944 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40