bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0570_orf1 Length=195 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000010975 75.5 8e-13 > 9258.ENSOANP00000010975 Length=357 Score = 75.5 bits (184), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 29/66 (43%), Positives = 47/66 (71%), Gaps = 0/66 (0%) Query 66 LTVDVGFSLSHAVPFVNYSTLEASALRSEIGGAHANAYLKNLLLTRGLSLEKNELFAQKL 125 L VD GF +H VP++N ++ ++LR + G+H NAY+K+++ TR ++LE NEL Q + Sbjct 163 LVVDCGFGSTHCVPYINGKPIQQASLRCMVAGSHLNAYMKHIVATRAVNLEHNELLVQHM 222 Query 126 KEETCF 131 KEE+C+ Sbjct 223 KEESCY 228 Lambda K H 0.313 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 45508314650 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40