bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0571_orf1 Length=165 Score E Sequences producing significant alignments: (Bits) Value 5833.PF07_0077 114 1e-24 > 5833.PF07_0077 Length=1032 Score = 114 bits (284), Expect = 1e-24, Method: Composition-based stats. Identities = 50/120 (41%), Positives = 71/120 (59%), Gaps = 0/120 (0%) Query 44 VKLSTERLVVPEILFRPQDGGSSECGVAELVYRAICKAPVEAQPFLSSQIFLVGGSTKFW 103 + L+ ER+ +PEILF PQD C + ELVYR I P Q + SQI++ GGSTKF Sbjct 901 INLTNERIGIPEILFNPQDINLEHCSIVELVYRCISLLPKHIQKYFVSQIYISGGSTKFR 960 Query 104 GFKERLWHELRGLLPEHWQIHIYQHEDPQHSAWLGASNWAHDDGVYMQFSVSRQQFLETG 163 FK RL+ ELR + P W I+IY H++ +S ++G W D +Y ++R+Q+ G Sbjct 961 NFKHRLYKELRQVFPSDWDINIYSHKNSLYSNYIGTYVWLSDPSIYNYNVITREQYFNFG 1020 Lambda K H 0.318 0.134 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 29254071491 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40