bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0605_orf3 Length=104 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_3550 61.2 8e-09 > 5807.cgd4_3550 Length=1229 Score = 61.2 bits (147), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 36/98 (36%), Positives = 53/98 (54%), Gaps = 3/98 (3%) Query 6 SSHFFR-ILDECGRRSLGDAEKTTNCVLLQVQQQMQKNISRACVSCFGVATACAASVCRR 64 +S FF+ ++ CGR SLG+ KT C+ + + IS CVSC+ + C + C+ Sbjct 1108 TSVFFQNLVIVCGRSSLGNGGKTAKCIQNRSFGPKELRISDQCVSCYKESATCGSKKCKS 1167 Query 65 SCFINTCSERCIDCNTKNCAQPLLQCAGCRQEALPVPC 102 +C +TC+ +C C KNCA L +C G LP PC Sbjct 1168 ACLTSTCNTKCQKCFEKNCASNLKECVGTSW--LPKPC 1203 Lambda K H 0.326 0.133 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22759408663 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40