bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0675_orf2 Length=146 Score E Sequences producing significant alignments: (Bits) Value 6239.C28F5.4 98.6 5e-20 > 6239.C28F5.4 Length=856 Score = 98.6 bits (244), Expect = 5e-20, Method: Compositional matrix adjust. Identities = 53/131 (40%), Positives = 78/131 (59%), Gaps = 1/131 (0%) Query 7 ANAYTRRFSTVFSFAVGAPALSQTLNLLKPFFLNPRFSAKPSNRETLAVHAEFLHKLNKD 66 +NAYT T +SF V + L L+ FFL+P+F+ + RE AV+ E+L K+N+D Sbjct 101 SNAYTDTDHTNYSFEVRSEKLYGALDRFAQFFLDPQFTESATEREVCAVNCEYLDKVNED 160 Query 67 ALRLSYLIRQ-SKLKTPFSSFSVGNLDSLVREPRKKGIDFLKEVRRFHDKWYSSNLMTAV 125 R + R SK +S F++GN +L+ +PR KGI+ + F+ WYSS++MT Sbjct 161 FWRCLQVERSLSKPGHDYSKFAIGNKKTLLEDPRTKGIEPRDVLLDFYKNWYSSDIMTCC 220 Query 126 IVGAESLDRLQ 136 IVG ESLD L+ Sbjct 221 IVGKESLDVLE 231 Lambda K H 0.323 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40