bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0792_orf1 Length=123 Score E Sequences producing significant alignments: (Bits) Value 42254.ENSSARP00000001267 104 7e-22 > 42254.ENSSARP00000001267 Length=1046 Score = 104 bits (260), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 52/101 (51%), Positives = 67/101 (66%), Gaps = 4/101 (3%) Query 1 RKALTAGYFTQAARLNRQGTFTTLKNPQTVEIHPQSSLFGSFPSFVVYTELTLTTKEYMR 60 RKA+TAGYF ARL R G + T+K QTV IHP SSLF P +++Y EL LTTKE+MR Sbjct 944 RKAITAGYFYHTARLTRSG-YRTVKQQQTVFIHPNSSLFEEQPRWLLYHELVLTTKEFMR 1002 Query 61 AVFEVRPEWLAEAAPHYYQQQQLQQP---KLPRNLAPNPQE 98 V E+ WL E APHYY+ ++L+ P K+P+ L +E Sbjct 1003 QVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKLGKTREE 1043 Lambda K H 0.317 0.131 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22834639773 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40