bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0867_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0230191 95.5 4e-19 > 44689.DDB_0230191 Length=714 Score = 95.5 bits (236), Expect = 4e-19, Method: Compositional matrix adjust. Identities = 47/107 (43%), Positives = 69/107 (64%), Gaps = 2/107 (1%) Query 1 YIPIVASVSEHQPPTWSTYFLDLHMIMFLAPLGLILSLQR-GGGLFFVGLYGVLACYFSA 59 +IPI+ASVSEHQP TW++YF DLH+++FL P GL Q+ F+ LYGV + YFS Sbjct 366 HIPIIASVSEHQPTTWASYFFDLHILVFLFPAGLYFCFQKLTDANIFLILYGVTSIYFSG 425 Query 60 VMVRLVLVLSPAASILAGIGAATLVAGVLSQCRK-VYPGDSGPARAA 105 VMVRL+LVL+P A ILA + + + + + + P D+ ++ + Sbjct 426 VMVRLMLVLAPVACILAAVAVSATLTTYMKKLKAPSSPSDANNSKES 472 Lambda K H 0.328 0.141 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40