bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0882_orf2 Length=101 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00034758001 74.3 9e-13 > 99883.GSTENP00034758001 Length=413 Score = 74.3 bits (181), Expect = 9e-13, Method: Compositional matrix adjust. Identities = 40/92 (43%), Positives = 57/92 (61%), Gaps = 7/92 (7%) Query 8 EEPLYLWDFNAPVGEDKVDKKTLPKILQLRRGELARGGRSKHTHLVDVDTSDLSHPWAQA 67 EE +Y DF+AP ED +K LPK++Q++ R GR+K+THLVD DT+ WAQ Sbjct 328 EEDVYKRDFSAPTLEDHFNKTILPKVMQVKN--FGRSGRTKYTHLVDQDTTSFDSAWAQE 385 Query 68 TRDLQGQKLLK-KAAGIKGANDFERPSLRKPK 98 + Q K K KAAG++ F+RP+++K K Sbjct 386 S--AQNSKFFKQKAAGVRDV--FDRPTVKKRK 413 Lambda K H 0.313 0.133 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22990353331 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40