bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0909_orf1 Length=146 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_590 135 3e-31 > 5807.cgd4_590 Length=129 Score = 135 bits (341), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 62/128 (48%), Positives = 86/128 (67%), Gaps = 1/128 (0%) Query 20 ERMLQLNPHFDSIGPQFVQVYYETFRNNRAGLAELYTENSLLTYEGTQFRGAAAIVQKLQ 79 ++ + LNP FD IG QFVQ YY+TF+ NR L LY S+LT+E TQF+G A IV K Sbjct 2 DQSINLNPQFDQIGKQFVQHYYQTFQTNRPALGGLYGPQSMLTWEDTQFQGQANIVNKFN 61 Query 80 QLP-AAVSHQLVTCDCQPTPHGGVLIIVCGDLAIEDNPPMKFTQTFNLVPNGSGTYAVFN 138 L V ++ DCQP+P+ G ++ V GD+ I+D P+KF+Q FNL+P+G+G + +FN Sbjct 62 SLNFQRVQFEITRVDCQPSPNNGSIVFVTGDVRIDDGQPLKFSQVFNLMPSGNGGFMIFN 121 Query 139 DCFRLCIG 146 D FRL +G Sbjct 122 DLFRLNLG 129 Lambda K H 0.322 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40