bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0921_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0395 74.3 1e-12 > 5833.PF11_0395 Length=4226 Score = 74.3 bits (181), Expect = 1e-12, Method: Composition-based stats. Identities = 39/95 (41%), Positives = 58/95 (61%), Gaps = 6/95 (6%) Query 2 SWMGIRWLIFWLNILFIFAA----LAFVLTNARDPGKKAPSEWHTADTVELSFFLTLIHH 57 S + I+W+IF+LN+LFI AA +A++ + + + W T DT+E F+L ++HH Sbjct 3804 SLLNIKWMIFFLNLLFISAACVFSIAYLWAISETDQTTSYTIWMTNDTIEFFFYLVILHH 3863 Query 58 NTGLLFQHIIFVDALLITAS--FSSAMLVSQPTTE 90 NTG+LFQ I VD L IT S F + +V TT+ Sbjct 3864 NTGMLFQTCILVDLLFITMSLTFIATSVVKTITTD 3898 Lambda K H 0.332 0.141 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23067334887 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40