bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0926_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0191399 77.8 8e-14 > 44689.DDB_0191399 Length=232 Score = 77.8 bits (190), Expect = 8e-14, Method: Compositional matrix adjust. Identities = 36/89 (40%), Positives = 56/89 (62%), Gaps = 3/89 (3%) Query 4 MEQAVSDLLKALPAGVLSEEVLLNTPRRAAEAFLYFTKGYELSLEAAVGSGVFAYTEETG 63 M+ +V LL +L E LL TP R ++A L+FT+GYE S++ +G +F E Sbjct 51 MQSSVKTLLSSLGEDP-DREGLLKTPLRMSKALLFFTQGYEQSVDEVIGEAIF--NENHH 107 Query 64 DTIVIKDLFVHSVCEHHLLPFHGTCSIAY 92 + +V++D+ + S+CEHH++PFHG C I Y Sbjct 108 EMVVVRDIDIFSLCEHHMVPFHGKCHIGY 136 Lambda K H 0.321 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22844715270 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40