bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0933_orf5 Length=185 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P4.14 78.2 1e-13 > 5833.MAL3P4.14 Length=432 Score = 78.2 bits (191), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 50/179 (27%), Positives = 83/179 (46%), Gaps = 28/179 (15%) Query 5 SIPKAKIAWFPLISQSRWELGLWDVRVDEASLGLCSPQAPCSAVVDSGTAGVGVSGEFAE 64 ++ I WFP+IS WE+ L D+++ +L LC + C A +D+G++ + F + Sbjct 271 TVEGKSIEWFPVISLYYWEINLLDIQLSHKNLFLCESKK-CRAAIDTGSSLITGPSTFIQ 329 Query 65 QLLNRIGAFSFCNSTEKSEMKRLSFLLAPFPGEDPTEFALD--PPEY-FDPSRSIGPSPD 121 LL +I C + K + +SF+L G+ E LD P +Y + + + + Sbjct 330 PLLEKINLERDC--SNKESLPIISFVLKNVEGK---EITLDFMPEDYIIEEGDTENNTLE 384 Query 122 CPVAFMPLQLPPGQGHTFVRPQRSARCCHFNSFSGIQVLGNVFLRKLYAVFDHGRARIG 180 C + MPL +PP +G F + GN F+RK Y +FD+ IG Sbjct 385 CVIGIMPLDVPPPRGPIF-------------------IFGNSFIRKYYTIFDNDHKLIG 424 Lambda K H 0.322 0.140 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40134932565 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40