bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0945_orf1 Length=164 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_2450 201 9e-51 > 5807.cgd1_2450 Length=915 Score = 201 bits (510), Expect = 9e-51, Method: Composition-based stats. Identities = 91/139 (65%), Positives = 107/139 (76%), Gaps = 9/139 (6%) Query 1 LTAPGRFSCPQDCHYCPNEPGQPRSYLSTEPAVLRANQNGWSPLKQFKDRAETLRRNGHV 60 LT+PG FSC DCHYCPNEPGQPRSYLSTEPAVLRANQN + +KQF+DR+ TL+ NGH+ Sbjct 190 LTSPGAFSCKHDCHYCPNEPGQPRSYLSTEPAVLRANQNSFDAIKQFRDRSITLKNNGHI 249 Query 61 VDKIEVLVLGGTWSGYPQDYQEEFIRDVYYAANVFGAPEPV--------RQPLSLEEEQS 112 +DKIEVLVLGGTWSGYP++YQ FIRD+YYAAN F + R+ L L EE Sbjct 250 IDKIEVLVLGGTWSGYPKEYQNAFIRDIYYAANTFTNKNNIYDNRDYIDREKLPLSEEVE 309 Query 113 LNETADCRIVGLTLVRCRP 131 LN+TA+CRI+GLTL RP Sbjct 310 LNQTAECRIIGLTL-ETRP 327 Lambda K H 0.319 0.136 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40