bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0966_orf3 Length=747 Score E Sequences producing significant alignments: (Bits) Value 10116.ENSRNOP00000057585 82.4 6e-14 > 10116.ENSRNOP00000057585 Length=367 Score = 82.4 bits (202), Expect = 6e-14, Method: Compositional matrix adjust. Identities = 101/398 (25%), Positives = 184/398 (46%), Gaps = 54/398 (13%) Query 6 RPASRPASHKET-PPAGQLTI----HRGRRPTSHSDEELANNTASDPTNGSAHEPANEPV 60 +P+ P+ H T PP Q TI H +PT H + + PTN +++P N+P Sbjct 18 QPSIHPSIHPSTHPPTNQPTIQPSIHPTNQPTIHPSIQ----PSIQPTNHPSNQPTNQPT 73 Query 61 DQPEAHPDSQPASQPDSRPASEQDDDPASEAVDFPASDLVGKPASEPASELASEAASVPF 120 QP HP +QP + P +P ++ + P ++ P+ +P + P Sbjct 74 IQPSIHPSNQPTNHPTIQPTNQPTNQPTNQPTIHPSIQPTIQPTNHP------------- 120 Query 121 SESREPASESDSQYTSEPASGPASETDREPASDSPSQTPSESATHPTSEQPSEPAS-EPT 179 S +P +Q T++P+ P++ P + + HP S PS AS +PT Sbjct 121 --SNQPTIHPTNQPTNQPSIHPSNHPTNHPT--------NHPSIHP-SIHPSIHASIQPT 169 Query 180 SEPTSEPISEPTSEPPIEPTSESPSEPVSDSPSQTPSKPAGEPTIEPSSETTIEPPGEPT 239 PT+ P ++P++ P I PT++ P +PTI PS++ T +P P+ Sbjct 170 IHPTNHPTNQPSNHPSIHPTNQ----------------PTFQPTIHPSNQPTNQPSIHPS 213 Query 240 SEPSSVPTSEPSSEPTSEPPREPVSDSPSQTPSEPASEPTRETATKPTSETPREPASESP 299 P++ PT++PS +PT++P P ++ PS +P + P+ + PT P+ Sbjct 214 IHPTNHPTNQPSIQPTNQPTIHP-TNHPS---IQPTNHPSNQRTIHPTIHPSIHPSIHPS 269 Query 300 SQPPSEPTSESLSQPPSEPATGPANKPASETASESPNQPAGEPASQPASYSDGQIDSWPD 359 QP ++PT P P+ P+N P ++ + P+ P + P+ + + P Sbjct 270 IQPSNQPTIHPTIHPSIHPSIHPSNHPTNQPSIHPSIHPSIHPTNHPSIHPTNHPTNHPS 329 Query 360 VEPHSQPAIETSVNSASEPASEPASESAGEHASMPTSE 397 + P P+I S++ + +P+++P+ + + PT++ Sbjct 330 IHPSIHPSIHPSIHPSIQPSNQPSIHPTNQPTNQPTNQ 367 Lambda K H 0.297 0.117 0.325 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 352991859935 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40