bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0984_orf2 Length=137 Score E Sequences producing significant alignments: (Bits) Value 44689.DDBDRAFT_0190426 68.2 6e-11 > 44689.DDBDRAFT_0190426 Length=549 Score = 68.2 bits (165), Expect = 6e-11, Method: Composition-based stats. Identities = 33/114 (28%), Positives = 68/114 (59%), Gaps = 1/114 (0%) Query 21 FTKRIALRFYLQSISAGIVGGIVGIGGSMVMGPLMLSRGMLPAVVTAVNTAAVLSSSSSA 80 +T + L + S+ AG + ++GIGG M+ GP++L G++P V A ++ +L +S+S+ Sbjct 401 YTYKNILLLGILSVIAGCLASLLGIGGGMIKGPVLLQMGLVPDVTAATSSYMILFTSASS 460 Query 81 AAKTLISGTVPWDYCLLFFCLCFAAALAGKFLVDKVVKRKKADHYLVLFLLAMI 134 A + ++ G + WDY ++++ + F + G + +VK+ + Y+V FL+ + Sbjct 461 AIQYILVGKLRWDYGIVYYVIGFVSCFIGTQTLIWIVKKYQRRSYIV-FLIGFV 513 Lambda K H 0.328 0.140 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22428990562 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40