bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0985_orf1 Length=240 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_3030 60.5 5e-08 > 5807.cgd7_3030 Length=882 Score = 60.5 bits (145), Expect = 5e-08, Method: Composition-based stats. Identities = 39/144 (27%), Positives = 69/144 (47%), Gaps = 26/144 (18%) Query 97 DALLALSALINASGPAVSPFAGEVADLLVLQMQHQHEPQEAAASAVAATASTPTNDSSSA 156 +++L+L++LI A SP+ E +++ +Q Sbjct 634 ESILSLTSLIVAMSHDFSPYVNECISIIIPLIQ-------------------------GY 668 Query 157 DELQAARICIELVGDLSRALGTEFGSLSDALLHGFYQLLRAPSVDRSLKPVVIVAVGDVA 216 DEL + IELVGDL R++G + ++ LL VDR +KP+ I+A+GD++ Sbjct 669 DELDTCKYSIELVGDLVRSVGKGINPSLEIIIKTLCALLAKNDVDRKVKPLAIIALGDIS 728 Query 217 LSLGGAKFAPFTPWLIELLVQAGV 240 ++L G F P+ +++L QA + Sbjct 729 MNL-GEDFIPYAISVLQLFQQASI 751 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 70473178052 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40