bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1007_orf1 Length=219 Score E Sequences producing significant alignments: (Bits) Value 3702.AT4G27780.1 112 1e-23 > 3702.AT4G27780.1 Length=354 Score = 112 bits (279), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 67/195 (34%), Positives = 104/195 (53%), Gaps = 14/195 (7%) Query 35 EFYGLFKQATQGDCDLRRPSALNVQGHAKWSAWEKHKGLPTSEAKAKYVSLALRL----- 89 + YGL+K AT+G C +PSAL + AKW AW+K +P EA KY+ + +L Sbjct 134 QLYGLYKIATEGPCTAPQPSALKMTARAKWQAWQKLGAMPPEEAMEKYIEIVTQLYPTWL 193 Query 90 -GLLRHG-----EGSTEGRTGLGPVQSRPVVDAEELGCFSSKGDAFCCLVAEGNFDAAVG 143 G ++ G + ++ R +GPV S V D E K DA EG + + Sbjct 194 DGGVKAGSRGGDDAASNSRGTMGPVFSSLVYDEESENEL--KIDAIHGFAREGEVENLLK 251 Query 144 ALLKDSSLVYITGEGGMTGLHFAADRGHANIAKMLIECGAELDCQDDWGETPLHVALAAG 203 ++ + V G T LH+A DRGH NIAK+L++ A+++ +D+ G+TPLH A+ Sbjct 252 SI-ESGIPVNARDSEGRTPLHWAIDRGHLNIAKVLVDKNADVNAKDNEGQTPLHYAVVCD 310 Query 204 QQELASMLIRAGANT 218 ++ +A L++ ANT Sbjct 311 REAIAEFLVKQNANT 325 Lambda K H 0.316 0.133 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 58561024608 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40