bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1061_orf1 Length=106 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P1.9 118 5e-26 > 5833.MAL3P1.9 Length=1254 Score = 118 bits (295), Expect = 5e-26, Method: Compositional matrix adjust. Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 0/104 (0%) Query 3 VLPVIFDYIFDCTLQMIKSDFQSYPDHRERFYALLKAANQHCFSGLFSLPSTQLKAFVES 62 +LP + +Y+ T+ MIK+DF SYP+HRE+FY L A +HCF LF+L S F++S Sbjct 995 ILPTVLNYVLLPTIDMIKNDFSSYPEHREKFYNFLDACVRHCFDYLFTLDSEIFNTFIQS 1054 Query 63 LVWAFKHEHPSLAEEGLQVTHEFLQRLIEGKREVLNDFCCNYYF 106 L+WA KHEHPS+A+ GL++T +FL +I K+E L +FC +Y+ Sbjct 1055 LLWAIKHEHPSVADHGLRITQQFLHNIIIKKKEYLEEFCKAFYY 1098 Lambda K H 0.328 0.140 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22605445551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40