bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1227_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE0450w 85.5 5e-16 > 5833.PFE0450w Length=1708 Score = 85.5 bits (210), Expect = 5e-16, Method: Composition-based stats. Identities = 51/127 (40%), Positives = 74/127 (58%), Gaps = 1/127 (0%) Query 26 FLAASGGFSSYYVVEKPSDAHELFELLRVYELGRCNALALQVLEKELSGRLAEAEAEAAR 85 F AS S + VVE P+DA LFE +R +GR N L+L VL K L + + E E Sbjct 754 FTIASNNCSDFVVVENPNDAVLLFEEVRKANIGRVNVLSLSVLNKNLMTIMLKNE-EIYT 812 Query 86 CTDTSAPRLLDLLHFISPRFKIAFFKSVGNTRVAADMEHATHLAYALRQRVVTLEGGLIE 145 + RL+DL+ F + ++KI F+ + T +A +E A +AY+ ++RVVT+ G LIE Sbjct 813 QLLPNVYRLIDLIKFKNDKYKICFYYIIKETLLANSLEQAHVIAYSHKKRVVTINGELIE 872 Query 146 LDGRMVG 152 DGR+ G Sbjct 873 NDGRICG 879 Lambda K H 0.326 0.142 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40