bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1228_orf1 Length=175 Score E Sequences producing significant alignments: (Bits) Value 10090.ENSMUSP00000029738 140 2e-32 > 10090.ENSMUSP00000029738 Length=455 Score = 140 bits (352), Expect = 2e-32, Method: Compositional matrix adjust. Identities = 67/175 (38%), Positives = 112/175 (64%), Gaps = 1/175 (0%) Query 1 EIEALEELSRELFVGLDDLVHSRAQALYGRTWLGRLNNMLGWGMTAVCVYRVFMSAANVL 60 E++ALEELSR+LF+ DL ++ + Y +T+ G+ N LG+ + CV+++FM+ N++ Sbjct 250 EVDALEELSRQLFLETADLYATKERIEYSKTFKGKYFNFLGYFFSIYCVWKIFMATINIV 309 Query 61 LDRVSTTDPATRTLELLLHLLHVPVDITLLTPYLSLVLLGWIIALTIRGFFEKLLTVFRY 120 LDRV TDP TR +E+ ++ L + D+ + ++S +L+G II +IRG L F Sbjct 310 LDRVGKTDPVTRGIEITVNYLGIQFDVKFWSQHISFILVGIIIVTSIRGLLITLTKFFYA 369 Query 121 MSTAVSSNVFALVMSEVMGMYFSACLLLTRVYLPQSYRDALAQVLAPSLDFRAFH 175 +S++ SSNV L+++++MGMYF + +LL R+ +P YR + +VL L F +H Sbjct 370 ISSSKSSNVIVLLLAQIMGMYFVSSVLLIRMSMPPEYRTIITEVLG-ELQFNFYH 423 Lambda K H 0.329 0.140 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 34716851512 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40