bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1242_orf1 Length=181 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G80380.2 105 7e-22 > 3702.AT1G80380.2 Length=456 Score = 105 bits (262), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 59/174 (33%), Positives = 99/174 (56%), Gaps = 13/174 (7%) Query 2 LERIKERNPKILLPKYDKSKMHGAGDRTEAAVLLDATD-LDVFLLEGWMLGFRRLDPQEL 60 L ++ + K+ +P+Y+KS G GDR +++ + L V L EGWMLGF+ L + Sbjct 288 LSKLTKEGLKMKVPRYNKSAYSGRGDRADSSTWPEVEGPLSVILFEGWMLGFKPLPADVV 347 Query 61 TATAYNLPEQEQAELRTINEALKDYERLY-SFVDLWLVLKVETANWVYNWRRQQEEDTRR 119 A +L +N+ L+ Y + ++D W+V+K++ ++VY WR Q E R+ Sbjct 348 KAV--------DPQLEVVNKNLEAYYDAWDKYIDAWVVIKIQDPSYVYRWRLQAEIAMRQ 399 Query 120 NTGSGLTADEVDGFVNRFMPLYAVYLPGLYANPPLSGKDPGGRSCLLVEVTEKR 173 + +G++ +EV+ FV+R++P Y YLP LYA P SG DP L +++ E+R Sbjct 400 DGQAGMSDEEVNDFVSRYLPAYKAYLPTLYAEGP-SGSDPD--RVLAIDIDEER 450 Lambda K H 0.318 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 37665090561 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40