bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1287_orf1 Length=134 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_3020 170 1e-41 > 5807.cgd1_3020 Length=369 Score = 170 bits (430), Expect = 1e-41, Method: Compositional matrix adjust. Identities = 79/118 (66%), Positives = 94/118 (79%), Gaps = 0/118 (0%) Query 1 TIGKRFASIGVENTEANRAAYRGLLFSTKGLGEYCSGAILFEETLYQKSPEGTPMVELLQ 60 TI KRF +G+ENTEANRAAYR LLF T+GL +Y SG IL+EETL+Q + G M +LL+ Sbjct 45 TIKKRFDQVGIENTEANRAAYRELLFKTEGLNQYISGVILYEETLFQSTASGEKMTDLLK 104 Query 61 QQGIIPGIKVDKGLETIPGTLGEQATMGLDGLSERCRKYYEAGARFAKWRAVLQIDAA 118 +QGI+PGIKVD GL T+P T GE +T GLDGL RC+KYY+AGARFAKWRAVL ID A Sbjct 105 KQGILPGIKVDMGLTTLPLTDGETSTTGLDGLGARCKKYYDAGARFAKWRAVLTIDQA 162 Lambda K H 0.315 0.133 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682284714 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40