bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1298_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000015532 125 3e-28 > 9031.ENSGALP00000015532 Length=609 Score = 125 bits (315), Expect = 3e-28, Method: Composition-based stats. Identities = 57/130 (43%), Positives = 89/130 (68%), Gaps = 4/130 (3%) Query 1 RLCQWSLQMMGQPAETLDL-KRGSRDVCVECVSFAEAEVNDLCLGSEDGCLMTANIHGNK 59 ++C WSL M+ QP ++++L + S+ V V C+SF +VN+ +GSE+G + TA HG+K Sbjct 377 KICSWSLDMLSQPQDSMELVHKQSKAVAVTCMSFPIGDVNNFVVGSEEGSVYTACRHGSK 436 Query 60 AGVMDVYEAHGGALTSLHFHPGMTEGSRDYSHLLLSSSVDWSIKLWSSKNLAEPLGCFEG 119 AG+ +++E H G +T +H H + G D+SHL ++SS DW++KLW++KN +PL FE Sbjct 437 AGISEMFEGHQGPITGIHCHAAV--GPVDFSHLFVTSSFDWTVKLWTTKN-NKPLYSFED 493 Query 120 SDAYVYDVKW 129 + YVYDV W Sbjct 494 NSDYVYDVMW 503 Lambda K H 0.318 0.133 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40