bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1304_orf3 Length=268 Score E Sequences producing significant alignments: (Bits) Value 402881.Plav_1645 68.9 2e-10 > 402881.Plav_1645 Length=600 Score = 68.9 bits (167), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 44/158 (27%), Positives = 71/158 (44%), Gaps = 22/158 (13%) Query 106 LYTADLEGHLRATWVSNSRFLSAGLCWVHAVDLTESDRLLLGVQLCHEVG-LHALAAAIS 164 +YT+ G+ +A + + R LS + + TE DR+ + + L H G + A+ ++ Sbjct 199 IYTSGTTGNPKAARIPHIRLLSMMGAFAAGTNATEKDRMYVVLPLYHSAGGVCAVGTTLT 258 Query 165 CRGALLLRSRCSLLSLWPDVKALDATIIFHTGMLWSRLLKAHERFNAGDETQRLGSWVGH 224 G++++R + S + W D AT+ + G L LL H Sbjct 259 VGGSVIIRQKFSATNFWDDAVKYKATLFQYIGELCRYLLNTPP----------------H 302 Query 225 PQ-----LRASIGTGLPGELWPVVKSVFNIPRILEFYS 257 P+ LR +G GL E+WP + F IP ILEFY Sbjct 303 PKERKHKLRMVVGNGLRPEIWPAFQKRFKIPHILEFYG 340 Lambda K H 0.322 0.136 0.442 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 85563639990 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40