bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1336_orf1 Length=185 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000085176 68.2 1e-10 > 7955.ENSDARP00000085176 Length=2418 Score = 68.2 bits (165), Expect = 1e-10, Method: Composition-based stats. Identities = 43/178 (24%), Positives = 81/178 (45%), Gaps = 17/178 (9%) Query 15 VTIWHNSTLRDTLPLHYSHFLNCIAQQRTGVVDAVFISNQPFEDND-----DKALDG--I 67 + + +N+ LR LP + + + ++N P D L G + Sbjct 1724 LNVLNNAILRANLP----------SSKGNPSAYGITVTNHPMNRTSASLSLDYLLQGTDV 1773 Query 68 VVAFFTIIAYSFVAAGVVIVCIVERVRKVRHQQILARVTPFQYWISSYIVDIILLILPCS 127 V+A F I+A SFV A V+ + E+ K +H Q ++ P YW+++YI D++ ++P + Sbjct 1774 VIAIFIIVAMSFVPASFVVFLVAEKSTKAKHLQFVSGCDPVTYWLANYIWDMLNYLVPAT 1833 Query 128 IIFGMILWIDVTPLVGPHQRGAFLLGSLLFCLSVCPLGYAISMGVDSPMTFVIVMLLL 185 ++ D+ P A L LL+ S+ P+ Y S + P T + ++++ Sbjct 1834 CCVLILFVFDLPAYTSPTNFPAVLSLFLLYGWSITPIMYPASFWFEVPSTAYVFLIVI 1891 Lambda K H 0.330 0.144 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40134932565 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40