bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1356_orf1 Length=136 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G47730.1 79.7 2e-14 > 3702.AT3G47730.1 Length=983 Score = 79.7 bits (195), Expect = 2e-14, Method: Composition-based stats. Identities = 45/129 (34%), Positives = 71/129 (55%), Gaps = 2/129 (1%) Query 1 MEEADYLCDRLAIMVDGVLASEGTALALKSRFGSGYIISIIFQKKDEREEQQAKKRLKQL 60 MEEAD L DR+ IM G L GT++ LKSRFG+G+I +I F + + + + + Sbjct 723 MEEADILSDRIGIMAKGRLRCIGTSIRLKSRFGTGFIANISFVESNNHNGEAGSDSREPV 782 Query 61 LQTFEYPPAIKEVSRHE--LRIISPFCHSFQLPLLFSELENRGALYGVESTVLGFASLEE 118 + F+ +K + ++ + + P L F+EL++R +G+ LG A+LEE Sbjct 783 KKFFKDHLKVKPIEENKAFMTFVIPHDKENLLTSFFAELQDREEEFGISDIQLGLATLEE 842 Query 119 VFLNVVRIA 127 VFLN+ R A Sbjct 843 VFLNIARKA 851 Lambda K H 0.322 0.137 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22513421946 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40