bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1361_orf1 Length=91 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G61780.1 72.8 3e-12 > 3702.AT1G61780.1 Length=98 Score = 72.8 bits (177), Expect = 3e-12, Method: Compositional matrix adjust. Identities = 39/98 (39%), Positives = 52/98 (53%), Gaps = 8/98 (8%) Query 2 MPCDKCEAKFTKLVTPD--------VKEGSKRIVGVNKLIEKATKKDKLVIVGSKCKICK 53 M CDKCE K +K++ PD V EG R + NKL+ K + +KC ICK Sbjct 1 MVCDKCEKKLSKVIVPDKWKDGARNVTEGGGRKINENKLLSKKNRWSPYSTCTTKCMICK 60 Query 54 TALHMKGKYCAPCAHVNGRCWMCGKRIVDVSKHNMSLV 91 +H GKYC CA+ G C MCGK+++D + S V Sbjct 61 QQVHQDGKYCHTCAYSKGVCAMCGKQVLDTKMYKQSNV 98 Lambda K H 0.322 0.135 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22919213550 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40