bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1425_orf1 Length=208 Score E Sequences producing significant alignments: (Bits) Value 351348.Maqu_1467 142 5e-33 > 351348.Maqu_1467 Length=413 Score = 142 bits (359), Expect = 5e-33, Method: Compositional matrix adjust. Identities = 68/170 (40%), Positives = 104/170 (61%), Gaps = 4/170 (2%) Query 37 VLGVTGFVGKLIAEYFCSNYGPSSGVKFLLAARTSQKLSNLKTELSRKFAFQEKDISTQV 96 V G T FVG+++A Y NYG VK+ +A R+ KL+ LK++L A + + Sbjct 13 VFGATSFVGQILARYLLENYGADKEVKWAIAGRSEGKLNQLKSDLGAGAA----SLPVIL 68 Query 97 ADVEDYASLLSLARRCRVLITTVGPYMLYGEPVARACVEARTHYCDLTAEMPFVAMLHAR 156 AD D +L L + RV+I+TVGPY L+GE + + C E T YCDLT E+ ++ + R Sbjct 69 ADAADEPALRDLCGQTRVVISTVGPYALFGETLVKVCAETGTDYCDLTGEVQWIRRMIER 128 Query 157 HGLAAKERGVKLISFCGFDSIPSDLCVFMIQNKAIELTGKPCKEVKLAVR 206 + AKE G +++ CGFDSIPSD+ V+ +Q ++ GKPC++V++ V+ Sbjct 129 YEAKAKESGARIVHCCGFDSIPSDMGVWFLQQQSEATFGKPCQDVRMRVK 178 Lambda K H 0.325 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 52674479614 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40