bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1491_orf2 Length=144 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_720 90.1 2e-17 > 5807.cgd7_720 Length=364 Score = 90.1 bits (222), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 44/110 (40%), Positives = 65/110 (59%), Gaps = 7/110 (6%) Query 5 TVRICVPRAVVGSLIGKNGGYIQSLRVATGATINISPLFVTAEEACAERIVSVESRKRQN 64 +R+ VPR+V+GS+IG G +I +R AT A INISP+FVT+E+AC ERI+++ Sbjct 110 NIRLAVPRSVIGSIIGIKGEFISHVRTATSAHINISPIFVTSEKACNERIITISGSNSNQ 169 Query 65 LKAAAFTLIKKINEHPDKGCCRHVCY-----FRK--HSFESPLAEPLAAA 107 + A L KK+N P+ C+ V Y FR+ H E +PL ++ Sbjct 170 VIHAFIILTKKVNSSPEGRSCKSVIYRRADFFRRKNHKTEHEKVDPLLSS 219 Lambda K H 0.321 0.129 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22567178795 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40