bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1553_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0067 103 2e-21 > 5833.PF14_0067 Length=1272 Score = 103 bits (256), Expect = 2e-21, Method: Composition-based stats. Identities = 47/104 (45%), Positives = 74/104 (71%), Gaps = 3/104 (2%) Query 2 SEFAHTQGASLHPALSSICTAAILDGLLTPSGGDLVLTAVGPVDQYTGTA---YNGIDSV 58 SEFA +G+S+HP+ +SIC AAI DG ++PSGG++++T ++ Y +N ++++ Sbjct 314 SEFAIIEGSSIHPSSTSICAAAIHDGSISPSGGEIIVTVASELNHYYTIKEKIFNELEAL 373 Query 59 DFAYSVDRKQYSFHMYLVDSVDLIETSVRIVDEYGKLSSVGRLE 102 DF+ D K ++F Y +DS+D I ++VRIVD +GKLSS+GRLE Sbjct 374 DFSAKADEKNFTFFTYHLDSIDDIISNVRIVDSFGKLSSLGRLE 417 Lambda K H 0.317 0.134 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40