bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1562_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_640 65.5 4e-10 > 5807.cgd5_640 Length=351 Score = 65.5 bits (158), Expect = 4e-10, Method: Compositional matrix adjust. Identities = 56/142 (39%), Positives = 86/142 (60%), Gaps = 3/142 (2%) Query 7 EKIIEVPKIQYRQVEVEKIVEVPQVQVQYVDVPVPVPQRHINVVQTQKVVEVLQQQVVEK 66 EKI+EVP+IQY++V +EKI+E+PQ+Q + V V VP ++T+K+VE+ Q +EK Sbjct 109 EKIVEVPQIQYKEVIMEKILEIPQIQEEIVWKDVVVPNIQPRYIETEKIVEIPVVQTIEK 168 Query 67 RVKVPTPRYIHRQRPVAQPPKTIYREIPKP--IPRYVKIPQPQDVYEEVEKPVFVTKYVE 124 V P+Y ++ + P I + +PK + + +P P D Y+EV+ P +V K VE Sbjct 169 LVHASVPQYKMIKQDINVPIVDI-KTVPKDCVLEKLKYVPVPVDRYQEVQVPKYVLKTVE 227 Query 125 RKVPVYTERIVEDPFPVKVPCE 146 VPV E+IVE+ PV + E Sbjct 228 VPVPVPIEKIVEEEVPVPISVE 249 Lambda K H 0.319 0.139 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40