bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1572_orf1 Length=140 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.321 73.6 2e-12 > 5833.MAL13P1.321 Length=827 Score = 73.6 bits (179), Expect = 2e-12, Method: Composition-based stats. Identities = 34/106 (32%), Positives = 62/106 (58%), Gaps = 0/106 (0%) Query 8 PIEAIHPRQEMVCLAQATRALGSFSGKIQYAVVLAGIEYIICSEFEIPVLGENKHVSAMG 67 P E + + E C+A+ T+ +G+F G +QY VV+ EYI+ + F+IP+LG+N S +G Sbjct 34 PPECLKSKGEEKCIAKFTKTMGNFYGILQYCVVINSDEYILNARFDIPLLGDNTATSIIG 93 Query 68 CNVDSRAQGLPEAKTLFDLSFSADASVFSNFVVTVRETPEGTAYLK 113 N+ + + + + F + +S D + S F + + ET EG +++ Sbjct 94 LNIKNEDKQILSQQNYFLVKYSFDNTYNSKFYINIVETEEGHRFIE 139 Lambda K H 0.319 0.133 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22914837435 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40