bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1592_orf1 Length=259 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_590 127 2e-28 > 5807.cgd7_590 Length=228 Score = 127 bits (320), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 70/197 (35%), Positives = 107/197 (54%), Gaps = 5/197 (2%) Query 40 MRFCWRYIVEKGKFNFEQVGLLPVVHTATVSRTHSGSKTMSGAAIITPFMQNGSVGAVMK 99 MR WRYI+ +F++ GL P++ T +H K A+ITP+ + G+ +++K Sbjct 1 MRGQWRYILLYCGGDFQESGLAPLIATTGTKYSHPKYKIRHALALITPYCEYGNGISLIK 60 Query 100 SLAGKTNTYAYEADLLLANARNLVSCMAFLEHYGVYHGNIHPYNIMVSDDGFRLLIGDFV 159 +L+G+ + Y Y DLL N ++ ++FLE Y ++HGNI NI V+ GF LL+GDF+ Sbjct 61 NLSGQRHIYYYTCDLLHYNLLLIIKALSFLESYEIFHGNIKLSNIYVNATGFILLLGDFM 120 Query 160 PPSEFKRWLVQVAKGLAAVPPYCSPEYYTALYDRRIQRPSAYVNTLSPHKHDVFCLGLVI 219 P K W +++ K A +P SPE AL + + + HK+DVFCL +V Sbjct 121 LPLRIKHWFIEIMKKNANIPLNVSPELRYALTKPNYKTYEDFEKEVDLHKNDVFCLAMVF 180 Query 220 LQLATLQNVTIYRDKPK 236 L L+ IY K K Sbjct 181 LSLS-----LIYEPKEK 192 Lambda K H 0.321 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 81075912214 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40