bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1610_orf4 Length=191 Score E Sequences producing significant alignments: (Bits) Value 99883.GSTENP00014935001 74.7 2e-12 > 99883.GSTENP00014935001 Length=335 Score = 74.7 bits (182), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 30/53 (56%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Query 126 TWDEFFEKCEDIR--PLESSDTFRVYSSGSSGPLLFLLHGAGHTSLSWACFTV 176 +W E+F++ ED+ P +S+D FR+Y +GS GPLL LLHG GH++LSWA FTV Sbjct 10 SWREYFDQMEDVNVGPADSTDIFRIYKAGSEGPLLVLLHGGGHSALSWAVFTV 62 Lambda K H 0.314 0.127 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 43048405750 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40