bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1669_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value 243233.MCA0485 122 2e-27 > 243233.MCA0485 Length=283 Score = 122 bits (307), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 58/112 (51%), Positives = 76/112 (67%), Gaps = 0/112 (0%) Query 1 LHSPLDTMEETLEAWRGLEAAVDSGYVRVLGISNCYSLSDLQQLHSAAKVKPAIVQNRFY 60 LHSPL ++TL+ WR +E D G R LGISNCY L++L+ ++VKPA+VQNRFY Sbjct 125 LHSPLSKEKDTLDVWRAMETVFDGGGARQLGISNCYRPELLERLYRWSRVKPAVVQNRFY 184 Query 61 AATGYDAELRAWCRGNQVVYQGFWTLTANPHILRNPVITRTASRLRCTPEQV 112 A T YD E+R +CR N++VYQ FWTLTANP IL + + A+ TP Q+ Sbjct 185 AETRYDREIREFCRQNRIVYQSFWTLTANPSILAHATVRALAATHGRTPAQI 236 Lambda K H 0.320 0.132 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40