bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1681_orf1 Length=120 Score E Sequences producing significant alignments: (Bits) Value 212042.APH_0674 161 4e-39 > 212042.APH_0674 Length=412 Score = 161 bits (408), Expect = 4e-39, Method: Compositional matrix adjust. Identities = 73/120 (60%), Positives = 96/120 (80%), Gaps = 0/120 (0%) Query 1 VSGHKIYGPKGVGALFVRARRPKVRLAPIIDGGGQERGMRSGTLPTPLIVGLGKAASLAL 60 +SGHKIYGP G+GAL+VR R P+VRL P++ GGGQERGMRSGT+PTPL VGLG+AA +AL Sbjct 209 ISGHKIYGPMGIGALYVRKRNPRVRLVPLLSGGGQERGMRSGTVPTPLAVGLGEAARIAL 268 Query 61 ECMDSDRRHVERMARLLLHRLQQQLPHITVNGSLNRRYLGNLNISFSFVEGESLLMSIGD 120 E MDS+ ++++ +L R+ LPH+ +NGS + R GNLN+SFS+VEGESL+MS+ D Sbjct 269 EEMDSESERIKKLRDVLYERIMNGLPHVVLNGSYSSRIAGNLNLSFSYVEGESLIMSVSD 328 Lambda K H 0.323 0.141 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40