bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1700_orf1 Length=195 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_780 139 5e-32 > 5807.cgd5_780 Length=1240 Score = 139 bits (350), Expect = 5e-32, Method: Compositional matrix adjust. Identities = 69/161 (42%), Positives = 101/161 (62%), Gaps = 1/161 (0%) Query 25 LRKMMQEQLDKLPITPFKDLLKPESTLSYVPYSSIEVIFNNFQLWGNLQNLHPACITYDF 84 ++K++ E + +PI P K L PE +SYVPYS+IE++FNN Q+WGNL N HPA ITYD Sbjct 630 IKKVITEYIKNIPIIPDKRFLTPE-LISYVPYSTIELVFNNRQVWGNLGNHHPALITYDL 688 Query 85 DDLWKWRPLLTEPADPIETDIIIATPIRDKKCQLLAEDLVGNVVEHIRMQRIKNGNDVSF 144 ++ +KWR + I D+II P++ + + L E + +V E+I + R K G D F Sbjct 689 NNPYKWRTFCGSKPENIFQDLIIEPPLQGRAVEKLEESISVSVEENIVLNRQKLGKDTLF 748 Query 145 EHREEMLSKLLFYLDLLEFRLHLDEAHNPGPPPNHLGWSSF 185 + E+ ++ YL LLEF+L LD ++PGPP NH WS+ Sbjct 749 DRSSELEERINAYLTLLEFKLSLDPLYDPGPPDNHTAWSAL 789 Lambda K H 0.318 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 45508314650 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40