bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1743_orf2 Length=168 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_190 119 3e-26 > 5807.cgd2_190 Length=136 Score = 119 bits (298), Expect = 3e-26, Method: Compositional matrix adjust. Identities = 64/139 (46%), Positives = 98/139 (70%), Gaps = 3/139 (2%) Query 30 MLSDGQRIGVGLCLLGLSLGFVGMLCFLDRALLTLGNLAFMSGIWLVLGGRKTLKFFVLK 89 M+ D ++IG+G C LG+ L +G+L F D+ALLT+GN F++G+ LVLG K +FF LK Sbjct 1 MMDDNRKIGLGCCGLGMILIILGVLLFFDKALLTIGNFTFVAGLTLVLGLSKVTRFF-LK 59 Query 90 PHKWKASLLYILGVLLIALGYSLIGLPLQLYGLLRLFASFLPQVLGAVRLSPIGCWILQL 149 P K K +L Y G+ +I + ++IG LQ++GL LF SFLP ++ ++LSP+ +IL+L Sbjct 60 PDKLKGTLFYFGGLFVIIVKSTIIGFILQMFGLFYLFNSFLPNIVSYIKLSPL-SFILEL 118 Query 150 PGLKQCTKWVLDGDKQLPL 168 PG+KQ ++W+ D ++LPL Sbjct 119 PGIKQLSEWIYD-QRRLPL 136 Lambda K H 0.331 0.150 0.494 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30377245073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40