bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1824_orf2 Length=178 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_4110 146 2e-34 > 5807.cgd4_4110 Length=321 Score = 146 bits (369), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 72/162 (44%), Positives = 112/162 (69%), Gaps = 5/162 (3%) Query 20 PAGCVWAVCIGAEVLFTEILKAVKRPDIIRPKFLKVENTYSEVLFCKCFVKRKTVFVFRF 79 PAG VWA C E+ F IL+A K+ D+ K + +E T+SEV+ C +++ + +VF+F Sbjct 44 PAGMVWACCFANEMDFPMILEAWKQGDL-SSKQIHIEMTFSEVV-CLRWLQNRICYVFKF 101 Query 80 GCIVAWDIDVEEQKALVAFMQPYLKEPLGA---NKEDDTMTYVWSDGATIKGDNIHLVTT 136 GC+V WD+ E+ A+V ++ ++K+PL +DD MTYVW + +IK DNIHLV+ Sbjct 102 GCVVGWDLTRAERVAIVNILKTFIKQPLHIRTDESQDDDMTYVWGERPSIKQDNIHLVSD 161 Query 137 NVFECLAYSYAFAQSVKLAFFETLVDADIERTKMIPESLART 178 ++ E L+YSYA +QSVKL+ FE++VD +I+ T+ +PESLA++ Sbjct 162 SLLERLSYSYALSQSVKLSVFESVVDQNIDSTRSLPESLAKS 203 Lambda K H 0.325 0.138 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35812709058 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40