bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1826_orf1 Length=184 Score E Sequences producing significant alignments: (Bits) Value 5141.NCU08445.1 80.1 3e-14 > 5141.NCU08445.1 Length=590 Score = 80.1 bits (196), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 56/185 (30%), Positives = 89/185 (48%), Gaps = 32/185 (17%) Query 3 LIRSLEGWCSTFTTDGWWSYEYCHPDSLVEYHKEPDGEVKGPLHLLGTLHASGDAAELIF 62 L+R LE C F + GWWSY+YC+ S+V+YH P+ + PL Sbjct 161 LMRGLENQCLHFVS-GWWSYQYCYGKSIVQYHAVPNPKGGPPL----------------- 202 Query 63 KRPDPANPTLRGTDTLPPRANGAPRFKFLPVEI-IDKPKQFSKSPTPA-----SSKVLAL 116 R + + GT +LPP ++ K +E+ ++ KQ S P + + L Sbjct 203 -RDKNSQEYILGT-SLPPSSHSQ---KGKQIEVPNNEQKQLSPPPNTELQAKDNQRYLVQ 257 Query 117 QLTNGTVCEGTDKQRSARVLFECPVGFPVLATHRIVQIEETSFCTYDLLIHTPLVCPHPK 176 +L GT+C+ T + R+ + + C P L+ RI I+E + C Y ++IHTP +C Sbjct 258 RLDGGTICDLTGRPRTIEIQYHCN---PALSGDRIGWIKEVTTCAYLMVIHTPRLCADVA 314 Query 177 LLPPR 181 LPP+ Sbjct 315 FLPPK 319 Lambda K H 0.319 0.138 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 39517472064 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40