bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_1833_orf3 Length=213 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0191365 172 5e-42 > 44689.DDB_0191365 Length=479 Score = 172 bits (437), Expect = 5e-42, Method: Compositional matrix adjust. Identities = 84/183 (45%), Positives = 116/183 (63%), Gaps = 4/183 (2%) Query 1 GGDLAALLRCHKRLSEAAARFVAVEVMLGLQQLQQQQVVYRDLKAANVLIDLDGHCRLAD 60 GG+L L+ R SE + A E++ L L +Q +VYRDLK N+L+D +GH + D Sbjct 235 GGELFFHLKREGRFSEPRVKIYAAEIVSALDHLHKQDIVYRDLKPENILLDSEGHICITD 294 Query 61 FGLAKKLTGQLKRTFSFCGSPEYLSPEMLLGSGHDHSVDLYALGCLIYELLVGFPPFFAA 120 FGL+KK+ TF+FCG+PEYL+PE+L G GH +VD ++LG L+YE+L G PPF++ Sbjct 295 FGLSKKIE-TTDGTFTFCGTPEYLAPEVLNGHGHGCAVDWWSLGTLLYEMLTGLPPFYSQ 353 Query 121 NRNVMYMKIMQGQLSFPASCQASAEARSLVSRLLSLEPLMRVGALGGVEEVMQHSWFAGV 180 N + MY KI+ G+L P S EA+SL+ LL+ E R+G GG EV QH WF + Sbjct 354 NVSTMYQKILNGELKIPTYI--SPEAKSLLEGLLTREVDKRLGTKGGG-EVKQHPWFKNI 410 Query 181 SWE 183 WE Sbjct 411 DWE 413 Lambda K H 0.323 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 54900960570 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40